GLUC_RAT   P06883


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P06883

Recommended name:Pro-glucagon

EC number:

Alternative names:

Cleaved into:

GeneID:

Gene names  (primary ):Gcg

Gene names  (synonym ):

Gene names  (ORF ):

Length:180

Mass:20,846

Sequence:MKTVYIVAGLFVMLVQGSWQHAPQDTEENARSFPASQTEPLEDPDQINEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIAEELGRRHADGSFSDEMNTILDNLATRDFINWLIQTKITDKK

Tissue specificity:Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. 1

Induction:

Developmental stage:Glucagon release is stimulated by hypoglycemia and inhibited by hyperglycemia, insulin, and somatostatin. GLP-1 and GLP-2 are induced in response to nutrient ingestion.

Protein families:


   💬 WhatsApp