BGAT1_RAT Q9ET32
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9ET32
Recommended name：Histo-blood group ABO system transferase 1
EC number：
Alternative names：
Cleaved into：
GeneID：65270
Gene names (primary )：Abo
Gene names (synonym )：Abo1
Gene names (ORF )：
Length：348
Mass：40,375
Sequence：MDLRGRPKCYSLHLGILPFIVLVLVFFGYGFLSHKIQEFRNPGGETCMATRQTDVQKVVSVPRMAYPQPNVLTPIRNDVLVFTPWLAPIIWEGTFNIDILNEQFKLQNTTIGLTVFAIKKYVVFLKLFLETAEQHFMVGHKVIYYVFTDRPSDVPQVPLGAGRKLVVLTVRNYTRWQDVSMHRMEMISHFSEQRFQHEVDYLVCGDVDMKFSDHVGVEILSALFGTLHPGFYRSRRESFTYERRPKSQAYIPRDEGDFYYAGGFFGGSVVEVHHLTKACHQAMVEDQANGIEAVWHDESHLNKYLLYHKPTKVLSPEYVWDQKLLGWPSIMKKLRYVAVPKNHQAIRN
Tissue specificity：Tongue, esophagus, large intestine, stomach, caecum, pancreas, uterus, seminal vesicle, submaxillary gland, parotid gland, thyroid gland, parathyroid gland, salivary gland and thymus (at protein level). Esophagus, large intestine, stomach, kidney, urinary bladder, uterus and thymus. 2 s
Induction：
Developmental stage：During a Nippostrongylus brasiliensis parasite infection. The expression is a transient event, with a maximum at day 6 of the 13-day-long infection. 1
Protein families：glycosyltransferase 6 family