HHEX_MOUSE   P43120


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P43120

Recommended name:Hematopoietically-expressed homeobox protein Hhex

EC number:

Alternative names:(Homeobox protein HEX) (mHex) (Homeobox protein PRH)

Cleaved into:

GeneID:15242

Gene names  (primary ):Hhex

Gene names  (synonym ):Prh Prhx

Gene names  (ORF ):

Length:271

Mass:29987

Sequence:MQFPHPGPAAAPAVGVPLYAPTPLLQPAHPTPFYIDDILGRGPAAPTPTPTLPSPNSSFTSLVSSYRTPVYEPTPVHPAFSHHPAAALAAAYGPSGFGGPLYPFPRTVNDYTHALLRHDPLGKPLLWSPFLQRPLHKRKGGQVRFSNDQTVELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPQSNKKDALDSLDTSCEQGQDLPSEQNKGASLDRSQCSPSPASQEDPDSEISEDSDQEVDIEGDKGYFNAG

Tissue specificity:

Induction:

Developmental stage:Expressed during hematopoiesis.

Protein families:


   💬 WhatsApp