SUMO2_RAT P61959
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P61959
Recommended name：Small ubiquitin-related modifier 2
EC number：
Alternative names：SMT3 homolog 2 Sentrin-2 Ubiquitin-like protein SMT3A (Smt3A)
Cleaved into：
GeneID：690244
Gene names (primary )：Sumo2
Gene names (synonym )：Smt3a, Smt3h2
Gene names (ORF )：
Length：95
Mass：10,871
Sequence：MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
Tissue specificity：
Induction：
Developmental stage：
Protein families：