VAMP2_RAT P63045
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P63045
Recommended name：Vesicle-associated membrane protein 2
EC number：
Alternative names：Synaptobrevin-2
Cleaved into：
GeneID：24803
Gene names (primary )：Vamp2
Gene names (synonym )：Syb2
Gene names (ORF )：
Length：116
Mass：12,691
Sequence：MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
Tissue specificity：Nervous system specific. A higher level expression is seen in the brain as compared to the spinal cord (PubMed:2472388). Expressed in hippocampal neurons (PubMed:19196426). 2 s
Induction：
Developmental stage：
Protein families：