CHIN_RAT   P30337


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P30337

Recommended name:N-chimaerin

EC number:

Alternative names:

Cleaved into:

GeneID:84030

Gene names  (primary ):Chn1

Gene names  (synonym ):Arhgap2, Chn

Gene names  (ORF ):

Length:334

Mass:38,224

Sequence:MPSKESWSGRKTNRATVHKSKQEGRQQDLLIAALGMKLGSQKSSVTIWQPLKLFAYSQLTSLVRRATLKENEQIPKYEKVHNFKVHTFRGPHWCEYCANFMWGLIAQGVKCADCGLNVHKQCSKMVPNDCKPDLKHVKKVYSCDLTTLVKAHITKRPMVVDMCIREIESRGLNSEGLYRVSGFSDLIEDVKMAFDRDGEKADISVNMYEDINIITGALKLYFRDLPIPLITYDAYPKFIESAKIVDPDEQLETLHEALRSLPPAHCETLRYLMAHLKRVTLHEKENLMSAENLGIVFGPTLMRSPELDPMAALNDIRYQRLVVELLIKNEDILF

Tissue specificity:In neurons in brain regions that are involved in learning and memory processes.

Induction:

Developmental stage:Increases in amount during brain development coincident with synaptogenesis.

Protein families:


   💬 WhatsApp