MYCBP_MOUSE   Q9EQS3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9EQS3

Recommended name:c-Myc-binding protein

EC number:

Alternative names:(Associate of Myc 1) (AMY-1)

Cleaved into:

GeneID:56309

Gene names  (primary ):Mycbp

Gene names  (synonym ):Amy1

Gene names  (ORF ):

Length:103

Mass:11970

Sequence:MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPTSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEATVEENKKLKAKLVQYEPPQEEKRAE

Tissue specificity:

Induction:MYCBP expression is synergistically activated by SP1 and GATA-1. {ECO:0000269|PubMed:12620400}.

Developmental stage:

Protein families:AMY1 family


   💬 WhatsApp