DFB39_MOUSE   Q70KL3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q70KL3

Recommended name:Beta-defensin 39

EC number:

Alternative names:(BD-39) (mBD-39) (Defensin, beta 39)

Cleaved into:

GeneID:360214

Gene names  (primary ):Defb39

Gene names  (synonym ):

Gene names  (ORF ):

Length:74

Mass:8552

Sequence:MKISYFLLLILSLGSSQINPVSGDDSIQCFQKNNTCHTNQCPYFQDEIGTCYDKRGKCCQKRLLHIRVPRKKKV

Tissue specificity:Only expressed in epididymis (caput, corpus and cauda). {ECO:0000269|PubMed:14718547}.

Induction:

Developmental stage:

Protein families:Beta-defensin family


   💬 WhatsApp