FAM3C_MOUSE Q91VU0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91VU0
Recommended name:Protein FAM3C
EC number:
Alternative names:(Interleukin-like EMT inducer)
Cleaved into:
GeneID:27999
Gene names (primary ):Fam3c
Gene names (synonym ):D6Wsu176e Ilei
Gene names (ORF ):
Length:227
Mass:24753
Sequence:MRVAGAAKLVVAVAVFLLTFYVISQVFEIKMDASLGNLFARSALDSAIRSTKPPRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINIALVNGKTGEVIDTKFFDMWGGDVAPFIEFLKTIQDGTVVLMATYDDGATKLTDEARRLIAELGSTSITSLGFRDNWVFCGGKGIKTKSPFEQHIKNNKETNKYEGWPEVVEMEGCIPQKQD
Tissue specificity:Ubiquitously expressed, with highest levels in the retina. Up-regulated in mammary epithelial cells and hepatocytes undergoing epithelial to mesenchymal transition (at protein level). {ECO:0000269|PubMed:15194199, ECO:0000269|PubMed:16959614, ECO:0000269|PubMed:20059962}.
Induction:By TGF-beta in epithelial cells. {ECO:0000269|PubMed:20154680}.
Developmental stage:Expressed at 15.5 dpc in the nonsensory epithelium of the inner ear and at lower levels in the vestibule of the inner ear, the brain and hair follicles. Expressed in the ganglion cell layer of the retina and in the ciliary body at 15.5 dpc. At later stages, retinal expression becomes restricted to the ganglion cell layer. {ECO:0000269|PubMed:15194199, ECO:0000269|PubMed:20059962}.
Protein families:FAM3 family