S14L3_RAT Q9Z1J8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z1J8
Recommended name:SEC14-like protein 3
EC number:
Alternative names:
Cleaved into:
GeneID:
Gene names (primary ):Sec14l3
Gene names (synonym ):
Gene names (ORF ):
Length:400
Mass:46,027
Sequence:MSGRVGDLSPKQAETLAKFRENVQDVLPALPNPDDYFLLRWLRARNFDLQKSEAMLRKYMEFRKTMDIDHILDWQPPEVIQKYMPGGLCGYDRDGCPVWYDIIGPLDPKGLLFSVTKQDLLKTKMRDCERILHECDLQTERLGRKIETIVMIFDCEGLGLKHFWKPLVEVYQEFFGLLEENYPETLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIVVLGNSWKEGLLKLISPEELPAHFGGTLTDPDGNPKCLTKINYGGEIPKSMYVRDQVKTQYEHSVQISRGSSHQVEYEILFPGCVLRWQFSSDGADIGFGVFLKTKMGERQKAGEMTEVLTSQRYNAHMVPEDGSLTCTEAGVYVLRFDNTYSFVHAKKVSFTVEVLLPDEGMQKYDEELTPI
Tissue specificity:Detected in a layer of supportive cells in olfactory epithelium, in the apical region of the trachea and in the surface layer of ciliated bronchial epithelium in the lung.
Induction:
Developmental stage:
Protein families: