S2547_RAT Q6J329
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6J329
Recommended name:Solute carrier family 25 member 47
EC number:
Alternative names:
Cleaved into:
GeneID:299316
Gene names (primary ):Slc25a47 By Similarity
Gene names (synonym ):Hdmcp
Gene names (ORF ):
Length:310
Mass:33,618
Sequence:MDFVAGAIGGVCGVAVGYPLDTVKVKIQTEAKYTSIWHCVRDTYRQERLWGFYRGLSLPVCTVSLVSSVSFGTYHHCLAHICRFRYGSTDVKPTKADITLSGCASGLVRVFLTSPTEVAKVRLQTQAQSQTQQRRPSASWTSVAPALCPAPTACLEPRPKYSGPLHCLVTVAREEGLRGLYKGSSALLLREGHSFATYFLSYAVLSEWLTPAGQSQPDVLGVLVAGGCAGVLAWAVATPMDVIKSRLQADGQGQQRYRGLLHCVVTSVREEGPRVLFKGLALNCCRAFPVNMVVFVAYEAVLRLTQGLLT
Tissue specificity:
Induction:
Developmental stage:
Protein families: