PA2G3_MOUSE Q8BZT7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BZT7
Recommended name：Group 3 secretory phospholipase A2
EC number：EC 3.1.1.4
Alternative names：(Group III secretory phospholipase A2) (GIII sPLA2) (sPLA2-III) (Phosphatidylcholine 2-acylhydrolase 3)
Cleaved into：
GeneID：237625
Gene names (primary )：Pla2g3
Gene names (synonym )：
Gene names (ORF )：
Length：504
Mass：56687
Sequence：MGVLGVLLGVLAFLEGSHTRHWDSTSCHLVQPIPGNPLGSLSFLGKDAQGLALFQAFWDTHHRLQVCIRQDESELITAFRALCAHEPLQHSFIQTPGPALQRALATLQSQWEACQRSQDSPTGAREKRAIEQSGAPDREHRRRRRGWTIPGTLWCGVGNSAENASELGVFHGPDLCCREHDQCPQTISPLQYNYGIRNFRFHTISHCDCDARFQQCLRSQGDSISDIMGVAFFNVLEIPCFVLKEQEACVAWNWWGGCRAYGSTPLAHLRPRTYYNASWKAEATSYTPSPQSPAPSKHPQKRGPQQTQARRHSTTTTTPFQTPAISSRPDMIPRGQPGVPHLGFQDGPKHQSAHRVCRSLRHLDQCEHQIKPQETKFHLLNSAQMPLFHCDCTRRLARFLRLHSPPAGTDKVWDLLGTTCFKLAPQLDCAEGKGCSRDHRAIKVSARHLQRLHKSRLHFRDKGTGGALAQPVEPPGSTMSFYSQCLQVTQAIWRRRGQKKFWSS
Tissue specificity：Expressed in dermal mast cells (at protein level) (PubMed:23624557). Highly expressed in EPCAM-positive colonic epithelial cells throughout the proximal to distal colon (at protein level) (PubMed:28947740). Expressed at lower levels in ileum section of small intestine and immune organs including bone marrow, spleen and lymph nodes (PubMed:28947740, PubMed:20424323). Expressed in stomach and lung (at protein level) (PubMed:17868035). Expressed in testis and epididymis and to a lesser extent in the seminal vesicles and prostate (PubMed:20424323). Detected in ovary, oviduct and uterus (PubMed:20424323). Expressed in Sertoli and Leydig cells as well as in epididymal epithelium particularly in apical border of principal cells in the corpus (at protein level) (PubMed:20424323). Present in cauda epididymal fluid (at protein level) (PubMed:20424323). Expressed in central nervous system, with high levels in spinal cord and at a lesser extent in brain (at protein level) (PubMed:17868035, PubMed:20424323). {ECO:0000269|PubMed:17868035, ECO:0000269|PubMed:20424323, ECO:0000269|PubMed:23624557, ECO:0000269|PubMed:28947740}.
Induction：
Developmental stage：Highly expressed in dorsal root ganglia of the developing brain at 12.5 dpc (at protein level). {ECO:0000269|PubMed:17868035}.
Protein families：Phospholipase A2 family