CDK18_RAT O35832
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35832
Recommended name：Cyclin-dependent kinase 18
EC number：EC:2.7.11.22
Alternative names：Cell division protein kinase 18 PCTAIRE-motif protein kinase 3 Serine/threonine-protein kinase PCTAIRE-3
Cleaved into：
GeneID：289019
Gene names (primary )：Cdk18
Gene names (synonym )：Pctaire3, Pctk3
Gene names (ORF )：
Length：451
Mass：51,882
Sequence：MNKMKNFKRRLSLSVPRPETIEESLTEFTEQFNQLHTQRNEDGRDEPGQLSPGVQYQQRQNQRRFSMEDLNKRLSLPMDIRLPQEFLQKLQLENPGLPKPLTRMSRRASLSDIGFGKLETYVKLDKLGEGTYATVFKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDLIHTDRSLTLVFEYLDSDLKQYLDHCGNLMNMHNVKIFMFQLLRGLAYCHRRKILHRDLKPQNLLINERGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCILYEMATGKPLFPGSTVKEELHLIFRLLGTPTEESWPGVTSISEFRAYNFPRYLPQPLLSHAPRLDTEGINLLTSLLLYESKSRMSAEAALSHPYFQSLGERVHQLDDTASIFSLKEIQLQKDPGYRGLAFQHPGRGKSRRQSIF
Tissue specificity：In brain, kidney, intestine and at a much lower level, in fetal tissues.
Induction：
Developmental stage：
Protein families：