NUDT7_MOUSE Q99P30
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99P30
Recommended name：Peroxisomal coenzyme A diphosphatase NUDT7
EC number：EC 3.6.1.-
Alternative names：(Nucleoside diphosphate-linked moiety X motif 7) (Nudix motif 7)
Cleaved into：
GeneID：67528
Gene names (primary )：Nudt7
Gene names (synonym )：
Gene names (ORF )：
Length：236
Mass：26857
Sequence：MSRPCGLPEPVRNNLIDDAKARLRKSDVGTRYSHLSSNKFSVLVPLLARGGKLYLMFTVRSDKLKREPGEVCFPGGKRDPVDTDDTATALREAQEEVGLHPHQVEVVSHLVPYVFDNDALVTPVVGFLDHNFQAQPNADEVKEVFFVPLDYFLHPQVYYQKQITQSGRDFIMHCFEYKDPETGVNYLIQGMTSKLAVLVALIILEQSPAFKIDFDLHDLIPSCERTFLWRYSLSKL
Tissue specificity：[Isoform 1]: Highly expressed in liver, brown adipose tissue and heart. Expressed at intermediate level in lung and kidney and at low level in brain. {ECO:0000269|PubMed:11415433, ECO:0000269|PubMed:18799520}.; [Isoform 2]: Expressed in liver, brown adipose tissue and heart at 20 times lower levels than isoform 1. {ECO:0000269|PubMed:18799520}.
Induction：[Isoform 1]: Expression decreases in response to peroxisome proliferators. {ECO:0000269|PubMed:18799520}.
Developmental stage：
Protein families：Nudix hydrolase family, PCD1 subfamily