ZDH12_RAT Q6DGF5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6DGF5
Recommended name：Palmitoyltransferase ZDHHC12 Curated
EC number：EC:2.3.1.225
Alternative names：DHHC domain-containing cysteine-rich protein 12 By Similarity (DHHC-12 By Similarity) Zinc finger DHHC domain-containing protein 12 Imported
Cleaved into：
GeneID：366014
Gene names (primary )：Zdhhc12
Gene names (synonym )：
Gene names (ORF )：
Length：267
Mass：31,029
Sequence：MALWPLLNSGMLVRTGHTVLTWGITLVLFLHDTELRQWEEQGELFLPLTFLLLVLGSLLLYLAVSLMDPGYVTAQPQPQEEPKEEQTAMVPQAIPLRRCRYCLVLQPLRARHCRECRRCVRRYDHHCPWMENCVGERNHPLFVAYLALQLVVLLWGLYLAWSGLQFFQPWGLWLRSTGLLFTTFLLLSFFALVVSLLLASHLYLVARNTTTWEFISSHRIAYLRQRTSNPFDRGPTRNLAHFFCGWPSGPWETLWAEEEEEGSSQVV
Tissue specificity：
Induction：
Developmental stage：
Protein families：DHHC palmitoyltransferase family