KISSR_RAT Q924U1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q924U1
Recommended name：KiSS-1 receptor
EC number：
Alternative names：G-protein coupled receptor 54 G-protein coupled receptor OT7T175 (rOT7T175) Kisspeptins receptor Metastin receptor
Cleaved into：
GeneID：78976
Gene names (primary )：Kiss1r
Gene names (synonym )：Gpr54
Gene names (ORF )：
Length：396
Mass：42,889
Sequence：MAAEATLGPNVSWWAPSNASGCPGCGVNASDGPGSAPRPLDAWLVPLFFAALMLLGLVGNSLVIFVICRHKHMQTVTNFYIANLAATDVTFLLCCVPFTALLYPLPTWVLGDFMCKFVNYIQQVSVQATCATLTAMSVDRWYVTVFPLRALHRRTPRLALTVSLSIWVGSAAVSAPVLALHRLSPGPHTYCSEAFPSRALERAFALYNLLALYLLPLLATCACYGAMLRHLGRAAVRPAPTDGALQGQLLAQRAGAVRTKVSRLVAAVVLLFAACWGPIQLFLVLQALGPSGAWHPRSYAAYALKIWAHCMSYSNSALNPLLYAFLGSHFRQAFCRVCPCGPQRQRRPHASAHSDRAAPHSVPHSRAAHPVRVRTPEPGNPVRRSPSVQDEHTAPL
Tissue specificity：Highest expression levels in the cerebrum and cecum. Moderate expression in the ovary, colon and placenta. Low levels in the uterus, small intestine, and thymus. Expressed only moderately in the placenta. No expression in kidney tissues. Has a complex and abundant central nervous system expression pattern. Expressed in brain regions such as pons, midbrain, thalamus, hypothalamus, hippocampus, amygdala, cortex, frontal cortex, and striatum. No expression in the cerebellum. Persistent expression is detected in hypothalamus throughout postnatal development, with maximum expression levels at puberty in both male and female. Hypothalamic expression changed throughout the estrus cycle and is significantly increased after gonadectomy, a rise that is prevented by sex steroid replacement both in males and females. 4 s
Induction：
Developmental stage：Expression detected in trophoblast giant cells (TGCs), the placenta-derived cell lineage aligned at the boundary between the uterus and placenta, at embryonic days 12.5 (12.5 dpc). However, expression is faint and only observed in some of these cells, and disappears by 15.5 dpc. 1
Protein families：