ABHDB_MOUSE Q8K4F5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8K4F5
Recommended name：Protein ABHD11
EC number：EC 3.-.-.-
Alternative names：(Alpha/beta hydrolase domain-containing protein 11) (Abhydrolase domain-containing protein 11) (Williams-Beuren syndrome chromosomal region 21 protein homolog)
Cleaved into：
GeneID：68758
Gene names (primary )：Abhd11
Gene names (synonym )：Wbscr21
Gene names (ORF )：
Length：307
Mass：33561
Sequence：MLRWARAWRVPRGVLGASSPRRLAVPVTFCSSRSSGQENADLRPLPLSYNLLDGDATLPAIVFLHGLFGSKTNFNSLAKAMVQRTGRRVLTVDARNHGDSPHSPDASYEAMSQDLQGLLPQLGLVPCVLVGHSMGGKTAMLLALQRPDVVERLVVVDISPVGTTPGSHIGAFIAAMKAVEIPEKVPHSQARKLADKQLSSVVKEAGIRQFLLTNLVEVGGRFSWRLNLDTLAQHLDKIMTFPQQREPYSGPTLFLLGGNSTYVQPSHHSEIRRLFPQAQIQTVPNAGHWVHSDKPQDFMDAVTSFLA
Tissue specificity：Expressed in white adipose tissues. {ECO:0000269|PubMed:17215164}.
Induction：Up-regulated by rosiglitazone and down-regulated by high fat feeding. {ECO:0000269|PubMed:17215164}.
Developmental stage：
Protein families：AB hydrolase superfamily