4EBP3_MOUSE   Q80VV3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q80VV3

Recommended name:Eukaryotic translation initiation factor 4E-binding protein 3

EC number:

Alternative names:(4E-BP3) (eIF4E-binding protein 3)

Cleaved into:

GeneID:108112

Gene names  (primary ):Eif4ebp3

Gene names  (synonym ):

Gene names  (ORF ):

Length:101

Mass:11019

Sequence:MSSSTSCPIPGCRDQLPDGYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTLPAVPPSKLELLKEQKQTEVEITDDEQFEMDM

Tissue specificity:

Induction:

Developmental stage:

Protein families:EIF4E-binding protein family


   💬 WhatsApp