SOAT_RAT   Q70EX6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q70EX6

Recommended name:Sodium-dependent organic anion transporter 1 Publication

EC number:

Alternative names:Solute carrier family 10 member 6 (SLC10A6)

Cleaved into:

GeneID:289459

Gene names  (primary ):Slc10a6

Gene names  (synonym ):Soat

Gene names  (ORF ):

Length:370

Mass:40,310

Sequence:MSADCEGNSTCPANSTEEDPPVGMEGQGSLKLVFTVLSAVMVGLVMFSFGCSVESRKLWLHLRRPWGIAVGLLCQFGLMPLTAYLLAIGFGLKPFQAIAVLIMGSCPGGTVSNVLTFWVDGDMDLSISMTTCSTVAALGMMPLCLYVYTRSWTLPQSLTIPYQSIGITLVSLVVPVASGIYVNYRWPKQATFILKVGAAVGGMLLLVVAVTGVVLAKGWNIDVTLLVISCIFPLVGHVMGFLLAFLTHQSWQRCRTISIETGAQNIQLCIAMMQLSFSAEYLVQLLNFALAYGLFQVLHGLLIVAAYQAYKRRQKSQYRRQHPECQDISSEKQPRETSAFLDKGAEAAVTLGLEQHHRTAELTSHVPSCE

Tissue specificity:Highly expressed in heart, lung, spleen and adrenal gland. Moderately expressed in skeletal muscle, testis and small intestine. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp