MP2K2_RAT P36506
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P36506
Recommended name：Dual specificity mitogen-activated protein kinase kinase 2
EC number：EC:2.7.12.2
Alternative names：MAP kinase kinase 2; MAPKK 2
Cleaved into：
GeneID：58960
Gene names (primary )：Map2k2
Gene names (synonym )：Mek2, Mkk2, Prkmk2
Gene names (ORF )：
Length：400
Mass：44,282
Sequence：MLARRKPVLPALTINPTIAEGPSPTSEGASEAHLVDLQKKLEELDLDEQQRKRLEAFLTQKAKVGELKDDDFERISELGAGNGGVVTKARHRPSGLIMARKLIHLEIKPAVRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEDILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVELAIGRYPIPPPDAKELEASFGRPVVDGADGEPHSVSPRPRPPGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPSGVFSSDFQEFVNKCLIKNPAERADLKLLTNHAFIKRSEGEDVDFAGWLCRTLRLKQPSTPTRTAV
Tissue specificity：Expressed abundantly in the adult brain and muscle.
Induction：
Developmental stage：
Protein families：