DPPA3_MOUSE Q8QZY3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8QZY3
Recommended name：Developmental pluripotency-associated protein 3
EC number：
Alternative names：(Compaction-associated protein 1) (Primordial germ cell protein 7)
Cleaved into：
GeneID：73708
Gene names (primary )：Dppa3
Gene names (synonym )：Cap1p Crg1 Pgc7
Gene names (ORF )：
Length：150
Mass：17670
Sequence：MEEPSEKVDPMKDPETPQKKDEEDALDDTDVLQPETLVKVMKKLTLNPGVKRSARRRSLRNRIAAVPVENKSEKIRREVQSAFPKRRVRTLLSVLKDPIAKMRRLVRIEQRQKRLEGNEFERDSEPFRCLCTFCHYQRWDPSENAKIGKN
Tissue specificity：Expressed in the immature oocytes and in newborn ovaries. Subsequently detected in maturing oocytes and in preimplantation embryos. Expressed in pluripotent embryonic but not in differentiated somatic cells. Expressed in blastocysts, epiblasts, primordial germ cells, embryonic gonads and primitive spermatogonia. No expression is detected in adult testes. {ECO:0000269|PubMed:11900980, ECO:0000269|PubMed:12124616, ECO:0000269|PubMed:12620990}.
Induction：
Developmental stage：Detected at 3.5 dpc (at protein level). Activated during the process of germ cell specification at 7 dpc.25, specifically in the founder population of lineage-restricted primordial germ cells (PGCs). Thereafter, expressed in the germ line until about 15.5 dpc in male and 13.5 dpc in female gonads. Expressed during blastocyst, morula and 4-cell embryo stages. {ECO:0000269|PubMed:11900980, ECO:0000269|PubMed:12620990, ECO:0000269|PubMed:14654002, ECO:0000269|PubMed:14684992}.
Protein families：