M1IP1_MOUSE Q9CQ20
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CQ20
Recommended name：Mid1-interacting protein 1
EC number：
Alternative names：(Gastrulation-specific G12-like protein) (Mid1-interacting G12-like protein) (Protein STRAIT11499 homolog) (Spot 14-related protein) (S14R) (Spot 14-R)
Cleaved into：
GeneID：68041
Gene names (primary )：Mid1ip1
Gene names (synonym )：Mig12
Gene names (ORF )：
Length：182
Mass：20356
Sequence：MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLSEPEIDEVSVEVGGSGGCLEERTTPAPSPGSANESFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPSSPPAGSEESTWKPKDILVGLSHLESADAGEEDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFSNWGH
Tissue specificity：During embryonic development, expressed mainly in the neuroepithelial midline, urogenital apparatus and digits. Detected in adult white fat, liver, heart, brain and kidney. Expressed at very low levels in lactating mammary gland. {ECO:0000269|PubMed:15070402, ECO:0000269|PubMed:15890771, ECO:0000269|PubMed:20457939}.
Induction：Down-regulated by fasting. Up-regulated by a carbohydrate-rich diet. {ECO:0000269|PubMed:20457939}.
Developmental stage：
Protein families：SPOT14 family