TP4A2_RAT Q6P9X4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6P9X4
Recommended name：Protein tyrosine phosphatase type IVA 2
EC number：EC:3.1.3.48
Alternative names：Protein-tyrosine phosphatase 4a2 Protein-tyrosine phosphatase of regenerating liver 2 (PRL-2)
Cleaved into：
GeneID：85237
Gene names (primary )：Ptp4a2
Gene names (synonym )：Prl2
Gene names (ORF )：
Length：167
Mass：19,127
Sequence：MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQ
Tissue specificity：Anterior pituitary, liver, brain, adrenal gland, kidney, testis and heart. Expression in the anterior pituitary is 3 fold higher in male as compared to female. 1
Induction：
Developmental stage：
Protein families：