S36A1_RAT Q924A5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q924A5
Recommended name:Proton-coupled amino acid transporter 1 1 Publication
EC number:
Alternative names:Lysosomal amino acid transporter 1 1 Publication (LYAAT-1 1 Publication) Neutral amino acid/proton symporter Solute carrier family 36 member 1 Imported
Cleaved into:
GeneID:155205
Gene names (primary ):Slc36a1
Gene names (synonym ):Lyaat1 1 Publication
Gene names (ORF ):
Length:475
Mass:52,569
Sequence:MSTQRLRNEDYHDYSSTDVSPEESPSEGLGSFSPGSYQRLGENSSMTWFQTLIHLLKGNIGTGLLGLPLAVKNAGLLLGPLSLLVIGIVAVHCMGILVKCAHHLCRRLNKPFLDYGDTVMYGLECSPSTWIRNHSHWGRRIVDFFLVVTQLGFCCVYFVFLADNFKQVIEAANGTTTNCNNNETVILTPTMDSRLYMLTFLPFLVLLSFIRNLRILSIFSLLANISMFVSLIMIYQFIVQRIPDPSHLPLVAPWKTYPLFFGTAIFAFEGIGVVLPLENKMKDSQKFPLILYLGMAIITVLYISLGSLGYLQFGADIKGSITLNLPNCWLYQSVKLLYSIGIFFTYALQFYVAAEIIIPAIVSRVPERFELVVDLSARTAMVCVTCVLAVLIPRLDLVISLVGSVSSSALALIIPPLLEVTTYYGEGISPLTITKDALISILGFVGFVVGTYESLWELIQPSHSDSSTNSTSAFI
Tissue specificity:Widely expressed and predominantly expressed in brain. Within the brain, expression restricted to neurons and not detected in glial cells. Abundant in regions rich in neurons using glutamate and GABA such as Purkinje cells in the cerebellum and pyramidal cells in the hippocampus. 2 s
Induction:
Developmental stage:
Protein families: