NDUV2_RAT P19234
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P19234
Recommended name：NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial By Similarity
EC number：EC:7.1.1.2
Alternative names：NADH-ubiquinone oxidoreductase 24 kDa subunit
Cleaved into：
GeneID：81728
Gene names (primary )：Ndufv2
Gene names (synonym )：
Gene names (ORF )：
Length：248
Mass：27,378
Sequence：MFSLALRARASGLTAQWGRHARNLHKTAVQNGAGGALFVHRDTPENNPDTPFDFTPENYERIEAIVRNYPEGHRAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRDSDSILETLQRKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDDYYEDLTPKDIEEIIDELRAGKVPKPGPRSGRFCCEPAGGLTSLTEPPKGPGFGVQAGL
Tissue specificity：
Induction：
Developmental stage：
Protein families：