INT12_RAT   Q68FR3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q68FR3

Recommended name:Integrator complex subunit 12

EC number:

Alternative names:PHD finger protein 22

Cleaved into:

GeneID:295448

Gene names  (primary ):Ints12

Gene names  (synonym ):Phf22

Gene names  (ORF ):

Length:461

Mass:48,477

Sequence:MAATVNLELDPIFLKALGFLHSKSKDSAEKLKTLLDESLARGIDASYRPAQKDVEPPKISSTKSLSIKQEPKTSSSLPSGSSNGKVLAAEKLKKEAEKRPADKMKDATEGVDVPKKPRLEKPETRSSPITVQTSKDLAMADLSSFEETSADDFAMEMGLACVVCRQMTVASGNQLVECQECHNLYHQDCHKPQVTDKEVNDPRLVWYCARCTRQMKRMAQKTQKPPQKPAPTVVSVAPTVKDPLVKKPETKLKQETTFLAFKRTEVKPSTVISGNSSSNNVSSSVTSGLTGWAAFAAKTSSAGPSTAKLNSTAQNSSGKPAASSASQKPVGLTGLATSSKGGIGSKIGSSNSTSPSVPLKPLPPLTLGKTGLSRSVSCDNVSKVGLPSPSSLVPGGSSQLSGNGNSATAGPTGSITSKTTSETSSSTSASLKGPTSQESQLNAMKRLQMVKKKAAQKKLKK

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp