RBM3_RAT Q925G0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q925G0
Recommended name：RNA-binding protein 3
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Rbm3
Gene names (synonym )：
Gene names (ORF )：
Length：155
Mass：16,855
Sequence：MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASDVMRAMNGESLDGRQIRVDHAGKSARGTRGGAFGAHGRGRSYSRGGGDQGYGSGRYDSRPGGYGYGYGRSRDYSGSQGGYDRYSGGNYRDNYDN
Tissue specificity：Widely expressed in the brain. Highly expressed in the cerebellum and olfactory bulb (at protein level). Expressed in neurons and glial cells. 1
Induction：
Developmental stage：
Protein families：