TM225_MOUSE   Q9D9S2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D9S2

Recommended name:Transmembrane protein 225

EC number:

Alternative names:

Cleaved into:

GeneID:75667

Gene names  (primary ):Tmem225

Gene names  (synonym ):Pmp22cd

Gene names  (ORF ):

Length:230

Mass:26483

Sequence:MMHIPNRSIQAANIFFSSGAILLLIVGLIMEDWVELIPKVRKDKTTHSPWLGCCPPFWPEESLEVVRRIMRMTLNISIYLNLIIGLQFSYMISQNKCVHLLVGFLSFFAGCLLFYAIIVYHHKLNKGQYVYFVNYKTKWIAFTVYLTIALFLTCGIFCFIQSTNRCECMKFCIPHTESKSQEMIPSTIEVVSLPPRCAMPRSIVHVHSVTSKDGSLNRPHTQARRVTWAL

Tissue specificity:Expressed in testis, epididymis and spermatozoa (at protein level). Not expressed in brain, heart, lung, liver, spleen, kidney and skeletal muscle. {ECO:0000269|PubMed:25605614}.

Induction:

Developmental stage:Detected in testis 25 days after birth and thereafter. {ECO:0000269|PubMed:25605614}.

Protein families:


   💬 WhatsApp