S39A1_MOUSE Q9QZ03
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QZ03
Recommended name：Zinc transporter ZIP1
EC number：
Alternative names：(Solute carrier family 39 member 1) (Zinc-iron-regulated transporter-like) (Zrt- and Irt-like protein 1) (ZIP-1) (mZIP1)
Cleaved into：
GeneID：30791
Gene names (primary )：Slc39a1
Gene names (synonym )：Zip1 Zirtl
Gene names (ORF )：
Length：324
Mass：34293
Sequence：MGPWGEPELLVWRPEAVASEPSVPVGLEVKLGALVLLLLLTLICSLVPVCVLRRSGANHEASASGQKALSLVSCFAGGVFLATCLLDLLPDYLAAIDEALEALHVTLQFPLQEFILAMGFFLVLVMEQITLAYKEQTSPPHPEETRALLGTVNGGPQHWHDGPGIPQAGGTPAAPSALRACVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILAVSLSLRLLQSHLRVQVVAGCGILFSCMTPLGIGLGAALAESAGPLHQLAQSVLEGMAAGTFLYITFLEILPQELATSEQRILKVILLLAGFALLTGLLFVQI
Tissue specificity：Ubiquitous. Highest levels seen in kidney, salivary gland and placenta. {ECO:0000269|PubMed:10610721}.
Induction：
Developmental stage：Found to be developmentally regulated in the skin where it is expressed in the epidermal layer, excluding the dermis, at embryonic day 17.5 dpc but not in 10.5 dpc and 15.5 dpc. In the small intestine found toward the base of the intestinal villi from 17.5 dpc. In the pancreas, expression was detected from 17.5 dpc and no expression was found in the liver. Also expressed in osteoblasts of developing bone from 15.5 dpc. {ECO:0000269|PubMed:10610721}.
Protein families：ZIP transporter (TC 2.A.5) family