CML1_RAT O35786
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35786
Recommended name:Chemerin-like receptor 1
EC number:
Alternative names:
Cleaved into:
GeneID:60669
Gene names (primary ):Cmklr1
Gene names (synonym ):Dez
Gene names (ORF ):
Length:372
Mass:41,865
Sequence:MEYEGYNDSSIYGEEYSDGSDYIVDLEEAGPLEAKVAEVFLVVIYSLVCFLGILGNGLVIVIATFKMKKTVNTVWFVNLAVADFLFNIFLPIHITYAAMDYHWVFGKAMCKISSFLLSHNMYTSVFLLTVISFDRCISVLLPVWSQNHRSVRLAYMTCVVVWVLAFFLSSPSLVFRDTVSTSHGKITCFNNFSLAAPEPFSHSTHPRTDPVGYSRHVAVTVTRFLCGFLIPVFIITACYLTIVFKLQRNRLAKTKKPFKIIITIIITFFLCWCPYHTLYLLELHHTAVPASVFSLGLPLATAVAIANSCMNPILYVFMGHDFKKFKVALFSRLVNALSEDTGPSSYPSHRSFTKMSSLIEKASVNEKETSTL
Tissue specificity:High expression in heart and lung, low in small intestines, colon, kidney, liver, uterus and brain. 1
Induction:
Developmental stage:
Protein families: