NECA2_MOUSE Q91ZP9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91ZP9
Recommended name：N-terminal EF-hand calcium-binding protein 2
EC number：
Alternative names：(EF-hand calcium-binding protein 2) (Neuronal calcium-binding protein 2)
Cleaved into：
GeneID：117148
Gene names (primary )：Necab2
Gene names (synonym )：Efcbp2
Gene names (ORF )：
Length：389
Mass：43441
Sequence：MCERAARLCRAGAHRLLREPPPQGRALGGLLRWVGARMGEPRAPLVPDIPSADPGPGPAASRGGTAVILDIFRRADKNDDGKLSLEEFQLFFADGVLNEKELEGLFHTIDSDNTNHVDTKELCDYFVEHMGDYEDVLASLETLNHSVLKAMGYTKKVYEGGSNVDQFVTRFLLKETANQIQSLLSSVESAVEAIEEQTSQIRQDHCKPSHAVNESRYGGPTPPYIPNHKLVAPEPMKSLPVATGEPKEDGLEGQISRLAELIGRLESKTLSFDLQQRLSDEEGTNMHLQLVRQEMAVCPEQLSEFLDSLRQYLRSTAEERNCFHVAAVRMADGLTFVIYEFWETEEEWKRHLQSPVCKAFRHVKVDTLSQPEALSQISVPAAWCTSGRD
Tissue specificity：Expressed in the iris, in the ciliary margin of the retina and in the inner portion of the neural retina. Expressed in the spinal dorsal horn with especially strong expression in lamina IIi; found in excitory synaptic boutons (at protein level). {ECO:0000269|PubMed:11641222, ECO:0000269|PubMed:26843217}.
Induction：Up-regulated by PAX6. {ECO:0000269|PubMed:11641222}.
Developmental stage：Expressed in retina, retinal pigmented epithelium, Rathke's pouch, corneal epithelium, the infundibulum and olfactory placodes at 10.5 dpc (at protein level). Expressed in the inner region of the neural retina, including the ganglion cell layer at 17.5 dpc (at protein level). Expressed in the optic sulcus and in the pre-tectum at 8.5 dpc. Expressed in the optic vesicle, in the midline position in the roof of the midbrain and in the pre-tectum at 9.0-9.5 dpc. Expressed in the olfactory placodes at 10.5 dpc. Expressed in retinal-pigmented epithelium and in the neural retina, with strong expression in the ciliary margin at 12.5-13.5 dpc. {ECO:0000269|PubMed:11641222}.
Protein families：