A1AG2_MOUSE P07361
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P07361
Recommended name：Alpha-1-acid glycoprotein 2
EC number：
Alternative names：(AGP 2) (Orosomucoid-2) (OMD 2)
Cleaved into：
GeneID：18406
Gene names (primary )：Orm2
Gene names (synonym )：Agp-2 Orm-2
Gene names (ORF )：
Length：207
Mass：23843
Sequence：MALHMILVMVSLLPLLEAQNPEHVNITIGDPITNETLSWLSDKWFFIGAAVLNPDYRQEIQKTQMVFFNLTPNLINDTMELREYHTIDDHCVYNSTHLGIQRENGTLSKYVGGVKIFADLIVLKMHGAFMLAFDLKDEKKRGLSLNAKRPDITPELREVFQKAVTHVGMDESEIIFVDWKKDRCSQQEKQQLELEKETKKDPEEGQA
Tissue specificity：Expressed by the liver and secreted in plasma.
Induction：Synthesis is controlled by glucocorticoids, interleukin-1 and interleukin-6, It increases 5- to 50-fold upon inflammation.
Developmental stage：
Protein families：Calycin superfamily, Lipocalin family