ZDHC7_MOUSE   Q91WU6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q91WU6

Recommended name:Palmitoyltransferase ZDHHC7

EC number:EC 2.3.1.225

Alternative names:(Acyltransferase ZDHHC7) (GABA-A receptor-associated membrane protein 2) (SERZ-beta) (Zinc finger DHHC domain-containing protein 7) (DHHC-7)

Cleaved into:

GeneID:102193

Gene names  (primary ):Zdhhc7

Gene names  (synonym ):Gramp2

Gene names  (ORF ):

Length:308

Mass:35213

Sequence:MQPSGHRLRDIEHHPLLTDNDNYDSASSSSSETDMADRVWFIRDGCGMVCAVMTWLLVVYADFVVTFVMLLPSKDFWYSVVNGVLFNCLAVLALSSHLRTMLTDPGAVPKGNATKEYMESLQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTMYIALSSVHALILCGLQFISCVRGQWTECSDFSPPITVILLVFLCLEGLLFFTFTAVMFGTQIHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRLRRLQMRTRKGGPEFSV

Tissue specificity:Ubiquitously expressed, with highest levels in liver, kidney and brain. Expressed in all brain regions. {ECO:0000269|PubMed:15603741}.

Induction:

Developmental stage:

Protein families:DHHC palmitoyltransferase family


   💬 WhatsApp