GLT10_RAT Q925R7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q925R7
Recommended name：Polypeptide N-acetylgalactosaminyltransferase 10
EC number：EC:2.4.1.41
Alternative names：Polypeptide GalNAc transferase 10 (GalNAc-T10; pp-GaNTase 10) Protein-UDP acetylgalactosaminyltransferase 10 UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 10
Cleaved into：
GeneID：170501
Gene names (primary )：Galnt10
Gene names (synonym )：
Gene names (ORF )：
Length：603
Mass：69,117
Sequence：MRRKEKRLLQAVALALAALVLLPNVGLWALYRERQPDGSPGGSGAAVAPEAIQELHSRQKKTLFLGAEQRLKDWHNKEAIRRDAQRVGNGEQGKPYPMTDAERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKLYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMALFPSVRILRTKKREGLIRTRMLGASAATGDVITFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVVAQKKLRGSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNVGTGLCTDTKHGTLGSPLRLETCIRGRGEAAWNSMQVFTFTWREDIRPGDPQHTKKFCFDAVSHTSPVTLYDCHSMKGNQLWKYRKDKTLYHPVSGSCMDCSESDHRIFMNTCNPSSLTQQWLFEHTNSTVLENFNRN
Tissue specificity：Highly expressed in the sublingual gland, testis, small intestine, colon and ovary. Expressed at intermediate level in heart, brain, spleen, lung, stomach, cervix and uterus. 1
Induction：
Developmental stage：
Protein families：