PO5F2_RAT   P56225


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P56225

Recommended name:POU domain, class 5, transcription factor 2

EC number:

Alternative names:

Cleaved into:

GeneID:RGD:1589456

Gene names  (primary ):Pou5f2

Gene names  (synonym ):Sprm1

Gene names  (ORF ):

Length:335

Mass:37,001

Sequence:MAGRRSSNVCPFPGNSGGGLEGPVPMRVDTPTWLSSQAATSRLMVRPGMGPGFCPGPEVWGVPLGPSPYEFRGGIAPYGAYETRTWSQNSSEDTYPGPYIALRYMPNLALPEDVSAIQKEMEQLAKELRQKRMTLGYSQADVGFAVGAMFGKVLSQTTICRFEAQQLSLANMWKLRPLLKMWLEEVDEKNLLGICRMEMILQQARKRRRASRERRIGSNLEKLFLQCPEPTPQQISYIAGRLRLQKDLVQVWFSNRSQMAGWPTNDSSQRENVGATGAPFPGPPVCFPLAPGLHFDFPHYGGSCLTPLYSSTPFPVRGALLSAPTTTLGLPRLSS

Tissue specificity:Highly restricted to adult testis.

Induction:

Developmental stage:Expressed transiently immediately prior to meiosis I during spermatogenesis in the male germ cell.

Protein families:


   💬 WhatsApp