RCN3_MOUSE Q8BH97
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BH97
Recommended name:Reticulocalbin-3
EC number:
Alternative names:
Cleaved into:
GeneID:52377
Gene names (primary ):Rcn3
Gene names (synonym ):D7Ertd671e
Gene names (ORF ):
Length:328
Mass:38002
Sequence:MMWRWSFLLLLLLLRHWALGKPSPDAGPHGQDRVHHGTPLSEAPHDDAHGNFQYDHEAFLGRDVAKEFDKLSPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYVQVEEYIADLYSEEPGEEEPAWVQTERQQFREFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTRHHDEL
Tissue specificity:Highly expressed in lung and heart. Also detected in liver, spleen, kidney, skeletal muscle, intestine, stomach, and brain. {ECO:0000269|PubMed:26252542}.
Induction:
Developmental stage:During lung development the expression is detected from 15.5 dpc to P1 with a maximum at 17.5 dpc which corresponds to the stage of development of alveolar saccules. {ECO:0000269|PubMed:26252542}.
Protein families:CREC family