SCN2B_RAT P54900
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P54900
Recommended name：Sodium channel regulatory subunit beta-2 1 Publication
EC number：
Alternative names：
Cleaved into：
GeneID：25349
Gene names (primary )：Scn2b
Gene names (synonym )：
Gene names (ORF )：
Length：215
Mass：24,145
Sequence：MHRDAWLPRPAFSLTGLSLFFSLVPSGRSMEVTVPTTLSVLNGSDTRLPCTFNSCYTVNHKQFSLNWTYQECSNCSEEMFLQFRMKIINLKLERFGDRVEFSGNPSKYDVSVTLKNVQLEDEGIYNCYITNPPDRHRGHGKIYLQVLLEVPPERDSTVAVIVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEEEGKTDGEGNAEDGAK
Tissue specificity：Detected in the earliest phase of neurogenesis in brain, and expression is greatly increased concomitant with axon extension and synaptogenesis.
Induction：
Developmental stage：
Protein families：