ACOT8_MOUSE P58137
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P58137
Recommended name：Acyl-coenzyme A thioesterase 8
EC number：EC 3.1.2.1
Alternative names：(Acyl-CoA thioesterase 8) (Choloyl-coenzyme A thioesterase) (Peroxisomal acyl-CoA thioesterase 2) (PTE-2) (Peroxisomal acyl-coenzyme A thioester hydrolase 1) (PTE-1) (Peroxisomal long-chain acyl-CoA thioesterase 1)
Cleaved into：
GeneID：170789
Gene names (primary )：Acot8
Gene names (synonym )：Pte1
Gene names (ORF )：
Length：320
Mass：35827
Sequence：MSAPEGLGDAHGDADRGDLSGDLRSVLVTSVLNLEPLDEDLYRGRHYWVPTSQRLFGGQIMGQALVAAAKSVSEDVHVHSLHCYFVRAGDPKVPVLYHVERIRTGASFSVRAVKAVQHGKAIFICQASFQQMQPSPLQHQFSMPSVPPPEDLLDHEALIDQYLRDPNLHKKYRVGLNRVAAQEVPIEIKVVNPPTLTQLQALEPKQMFWVRARGYIGEGDIKMHCCVAAYISDYAFLGTALLPHQSKYKVNFMASLDHSMWFHAPFRADHWMLYECESPWAGGSRGLVHGRLWRRDGVLAVTCAQEGVIRLKPQVSESKL
Tissue specificity：Ubiquitous. {ECO:0000269|PubMed:11673457}.
Induction：Induced in the liver, by peroxisome proliferator or fasting via the peroxisome proliferator-activated receptors (PPARs). Diurnal regulation of its expression. {ECO:0000269|PubMed:11673457}.
Developmental stage：
Protein families：C/M/P thioester hydrolase family