CI116_MOUSE Q5BN45
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5BN45
Recommended name:UPF0691 protein C9orf116 homolog
EC number:
Alternative names:(p53-induced expression in RB-null cells protein 1) (Pierce1)
Cleaved into:
GeneID:69327
Gene names (primary ):
Gene names (synonym ):
Gene names (ORF ):
Length:167
Mass:18836
Sequence:MSEEKPQQSAEEPEPGEPKAKPAPEEPEPGEPKAKPAPEEPEPGEPKAKPAPEKTSDYYRISEKLPVRFNNPGWFHGYGTKEAVSMYRTSNQTYGSRAPTVHEMPKVFYPSSNKFSRQHAAFGMFQSHNINVTLEKSLVTGPDNHITHYDRLNFHPSYNVNRPSICD
Tissue specificity:Expressed in brain, lung, kidney and testis. {ECO:0000269|PubMed:18182857}.
Induction:By p53/TP53. Protein levels are stabilized following gamma-irradiation. {ECO:0000269|PubMed:21159655}.
Developmental stage:May be up-regulated during progression from G1 to S phase of the cell cycle. Maximal expression in S or G2 phase. {ECO:0000269|PubMed:18182857}.
Protein families:UPF0691 family