AF1Q_MOUSE   P97783


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P97783

Recommended name:Protein AF1q

EC number:

Alternative names:

Cleaved into:

GeneID:56772

Gene names  (primary ):Mllt11

Gene names  (synonym ):Af1q

Gene names  (ORF ):

Length:90

Mass:10029

Sequence:MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTPTYESKDSSSVGKMNGQASGTEQKNPEGDPLLEYSTFNFWRAPIASIHSVDLDLL

Tissue specificity:Detected in embryonic brain cortex. {ECO:0000269|PubMed:15530661}.

Induction:Up-regulated during neuronal differentiation (in vitro). {ECO:0000269|PubMed:15530661}.

Developmental stage:

Protein families:MLLT11 family


   💬 WhatsApp