DLX1_MOUSE   Q64317


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q64317

Recommended name:Homeobox protein DLX-1

EC number:

Alternative names:

Cleaved into:

GeneID:13390

Gene names  (primary ):Dlx1

Gene names  (synonym ):

Gene names  (ORF ):

Length:255

Mass:27309

Sequence:MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGHSQPDGAYSSASSFSRPLGYPYVNSVSSHASSPYISSVQSYPGSASLAQSRLEDPGADSEKSTVVEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGSSAGSYVPSYTSWYPSAHQEAMQQPQLM

Tissue specificity:Expressed in a restricted region of the developing brain, within the diencephalon and the adjacent telencephalic regions. {ECO:0000269|PubMed:1676488}.

Induction:

Developmental stage:Expressed in developing retinal progenitor cells at 12 dpc (PubMed:21875655). Has a segmental expression in the developing forebrain (PubMed:1676488). {ECO:0000269|PubMed:1676488, ECO:0000269|PubMed:21875655}.

Protein families:Distal-less homeobox family


   💬 WhatsApp