YIF1B_RAT Q6PEC3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6PEC3
Recommended name:Protein YIF1B
EC number:
Alternative names:
Cleaved into:
GeneID:
Gene names (primary ):Yif1b
Gene names (synonym ):
Gene names (ORF ):
Length:259
Mass:28,418
Sequence:MHATGLAAPAGTPRLRKWPSKRRVPVSQPGMADPHQFFDDTSSAPSRGYGGQPSPGSLGYPTSSSEAAFLAAPMSNMAMAYGSSLAAQGKELVDKNIDRFIPVSKLKYYFAVDTVYVGKKLGLLVFPYLHQDWEVQYQQDTPVAPRFDINAPDLYIPAMAFITYILVAGLALGTQDRMIGGVLTGLLFGKIGYYLVLAWCCVSIFVFMIRTLRLKILAQAAAEGVPVRGARNQLRMYLTMAVAAAQPVLMYWLTFHLVR
Tissue specificity:Highly expressed in brain. Expressed in heart, kidney, and lung and lower levels in spleen, muscle, and intestine (at protein level) (PubMed:18685031). Expressed in serotoninergic neurons (at protein level) (PubMed:18685031). 1
Induction:
Developmental stage:
Protein families: