NTAL_RAT   Q8CGL2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8CGL2

Recommended name:Linker for activation of T-cells family member 2

EC number:

Alternative names:

Cleaved into:

GeneID:317676

Gene names  (primary ):Lat2

Gene names  (synonym ):Lab, Ntal, Wbscr5

Gene names  (ORF ):

Length:204

Mass:23,130

Sequence:MNAELELLWPLSGLLLLLLLGTTAWLCVQCSRPGVKRNEKIYEQRNQQENEQSVASSQTYSLARPVRTGLQMDAASNKSFERKNKLLFSHLEGPESPRYQNFYKGSRRESDAAYVDPIPTDYYNWGCFQKPPEDNDSNSYENVLICKPSTPESGTEESEDYQNSVSILQWRESKRTMGARTSPSGSPDEEPDYVNGDVATTEKI

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp