PO6F1_RAT P56223
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P56223
Recommended name：POU domain, class 6, transcription factor 1
EC number：
Alternative names：
Cleaved into：
GeneID：116545
Gene names (primary )：Pou6f1
Gene names (synonym )：Brn5
Gene names (ORF )：
Length：301
Mass：32,702
Sequence：MPGISSPILTNAQGQVIGALPWVVNSASVATPAPAQSLQVQAVTPQLLLNAQGQVIATLASSPLPQPVAVRKPSTPESPAKSEVQPIQPTQAVPPPAVILTSPAPALKPSASAPIPITCSETPTVSQLVSKPHTPSLDEDGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQIP
Tissue specificity：In the embryo, widely expressed, with highest levels in the developing brain and spinal cord. In the adult, mostly found in the brain, where it is diffusely expressed with the exception of an enrichment in layer IV of the neocortex. Also found in kidney, lung, heart, adrenal, skin, and placenta. Low levels in spleen, muscle, liver, anterior pituitary, testis and ovary.
Induction：
Developmental stage：
Protein families：POU transcription factor family