LYZL6_MOUSE Q9DA11
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9DA11
Recommended name：Lysozyme-like protein 6
EC number：EC 3.2.1.17
Alternative names：
Cleaved into：
GeneID：69444
Gene names (primary )：Lyzl6
Gene names (synonym )：Lyc1
Gene names (ORF )：
Length：148
Mass：16818
Sequence：MLKALFICVASCLLVVNDGNIIHRCSLAKILYEEDLDGFEGYSLPDWLCLAFVESNFNISKVNENVDGSFDYGIFQINSRYWCNDYQSHSENFCHVDCQELLSPNLISTIHCAKKIVSGPGGMKNWVEWKLHCLGRPLSYWMTGCHLG
Tissue specificity：Expressed strongly in testis and epididymis and weakly in seminal vesicle, vas deferens, kidney and spleen (PubMed:24013621). Highly expressed in primary spermatocytes and round spermatids (at protein level) (PubMed:24013621). {ECO:0000269|PubMed:24013621}.
Induction：
Developmental stage：In testis expressed from day 21 during postnatal development (PubMed:24013621). In the epidydimis, first detected at day 28 and high expression is maintained until day 35. Thereafter, level declines gradually (PubMed:24013621). {ECO:0000269|PubMed:24013621}.
Protein families：Glycosyl hydrolase 22 family