BPIA2_RAT Q63471
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q63471
Recommended name：BPI fold-containing family A member 2
EC number：
Alternative names：
Cleaved into：
GeneID：50585
Gene names (primary )：Bpifa2
Gene names (synonym )：Psp
Gene names (ORF )：
Length：235
Mass：24,529
Sequence：MFQLGSLVVLCGLLIGTSESLLGDVANAVNNLDILNSPSEAVAQNLNLDVGSLQQATTWPSAKDSILETLNKVELGNSNGFTPLNGLLLRVNKFRVLDLQAGLSSNGKDIDLKLPLVFEISFSLPVIGPTLDVAVSLDLLNSVSVQTNAQTGLPGVTLGKCSGNTDKISISLLGRRLPFVNRILDGVSGLLTGAVSILLQNILCPVLQYLLSTMSGSAIQGLLSNVLTGQLAVPL
Tissue specificity：Expressed in parotid, submandibular and sublingual glands. 1
Induction：
Developmental stage：Detected in neonatal submandibular and parotid gland secretion but not in sublingual gland secretion (at protein level). In submandibular gland, expressed at high levels in the first postnatal week, with expression diminishing thereafter. 1
Protein families：