APR_MOUSE   Q9JM54


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JM54

Recommended name:Phorbol-12-myristate-13-acetate-induced protein 1

EC number:

Alternative names:(Protein Noxa)

Cleaved into:

GeneID:58801

Gene names  (primary ):Pmaip1

Gene names  (synonym ):Noxa

Gene names  (ORF ):

Length:103

Mass:11566

Sequence:MPGRKARRNAPVNPTRAELPPEFAAQLRKIGDKVYCTWSAPDITVVLAQMPGKSQKSRMRSPSPTRVPADLKDECAQLRRIGDKVNLRQKLLNLISKLFNLVT

Tissue specificity:Detected in thymocytes after irradiation with X-rays. Not detectable in untreated thymocytes (at protein level). Detected in embryonic neural precursor cells of the telencephalon Constitutively expressed at low levels in adult brain, testis, thymus, spleen, lung and kidney. {ECO:0000269|PubMed:16822983}.

Induction:Up-regulated after exposure to ionizing radiation and other genotoxic agents. Up-regulation is mediated by p53. {ECO:0000269|PubMed:16822983}.

Developmental stage:

Protein families:PMAIP1 family


   💬 WhatsApp