ZNT8_RAT P0CE46
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P0CE46
Recommended name：Proton-coupled zinc antiporter SLC30A8 1 Publication
EC number：
Alternative names：
Cleaved into：
GeneID：299903
Gene names (primary )：Slc30a8
Gene names (synonym )：Znt8 1 Publication
Gene names (ORF )：
Length：368
Mass：40,128
Sequence：MEFLERTYLVNDQATKMYAFTSDRERGQKPVNKDQCPGDGPERPEAGAIYHCHNSFKATGNRSSKQVHAKWRLCAASAICFFFMVAEVVGGHVAGSLAVLTDAAHLLIDLTSFLLSLFSLWLSSRPPSKRLTFGWYRAEILGALLSVLCIWVVTGVLVYLACERLLYPDYQIQAGIMITVSGCAVAANIVLTLILHQRHLGHNHKDAQANASVRAAFVHALGDVFQSTSVLISALIIYFKPDYKMADPVCTFISSVLALASTVMILKDFSILLMEGVPKGLSYNSVKELLLTVDGVISVHNLHIWSLTVNQVILSVHVATAASQDSQSVRTGIACALSSSFDLHSLTIQIESAADQDPSCLLCEDPQD
Tissue specificity：Expressed in endocrine pancreatic islet alpha and beta cells. May be more abundant in beta cells than in alpha cells. Expressed in cubical epithelium lining thyroid follicles (at protein level). In the adrenal gland, detected in the cortex, but not in the medulla (at protein level). 1
Induction：
Developmental stage：Down-regulated by IL1B and IFNG. 1
Protein families：