TBCB_MOUSE Q9D1E6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D1E6
Recommended name：Tubulin-folding cofactor B
EC number：
Alternative names：(Cytoskeleton-associated protein 1) (Cytoskeleton-associated protein CKAPI) (Tubulin-specific chaperone B)
Cleaved into：
GeneID：66411
Gene names (primary )：Tbcb
Gene names (synonym )：Ckap1
Gene names (ORF )：
Length：244
Mass：27386
Sequence：MEVTGISAPTVMVFISSSLNSFRSEKRYSRSLTIAEFKCKLELVVGSPASCMELELYGADDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGVRLGEYEDVSKVEKYEISPEAYERRQNTVRSFMKRSKLGPYNEELRAQQEAEAAQRLSEEKAQASAISVGSRCEVRAPDHSLRRGTVMYVGLTDFKPGYWVGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPSAVTVGDFPEEDYGLDEM
Tissue specificity：Widely expressed with highest levels in brain. Broadly distributed throughout the neonate brain but restricted mainly to ependymary cells in the adult brain where it is concentrated in the cilia. {ECO:0000269|PubMed:17217416}.
Induction：
Developmental stage：In the embryo, expression increases at 12.5 dpc-14.5 dpc. Levels are highest in pre- and postnatal stages which coincide with peaks of cerebral and cerebellar neurogenesis (at protein level). {ECO:0000269|PubMed:17217416}.
Protein families：TBCB family