ID2_MOUSE   P41136


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P41136

Recommended name:DNA-binding protein inhibitor ID-2

EC number:

Alternative names:(Inhibitor of DNA binding 2) (Inhibitor of differentiation 2)

Cleaved into:

GeneID:15902

Gene names  (primary ):Id2

Gene names  (synonym ):Id-2 Idb2

Gene names  (ORF ):

Length:134

Mass:14959

Sequence:MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVTKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKVLCG

Tissue specificity:

Induction:Expressed in a circadian manner in the liver with peak levels seen at CT12 (at protein level). Expressed in a circadian manner in the suprachiasmatic nucleus (SCN) of the brain and heart with peak levels seen between CT16 and CT20 in the SCN and between CT8 and CT12 in the heart. {ECO:0000269|PubMed:19217292, ECO:0000269|PubMed:19740747}.

Developmental stage:

Protein families:


   💬 WhatsApp